ADORA3 Mouse Monoclonal Antibody (M01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Enzyme-Linked Immunoabsorbent Assay
Specification
- Clone:
- 1A3
- Description:
- ADORA3 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant ADORA3 (121 a.a. - 225 a.a) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG2b kappa
- Sequence:
- VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- ADORA3
- Gene Description:
- Adenosine A3 receptor (ADORA3) is a protein coding gene, which encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Alternative splicing results in multiple transcript variants. This gene shares its 5' terminal exon with some transcripts from overlapping GeneID:57413, which encodes an immunoglobulin domain-containing protein. [provided by RefSeq, Nov 2014]
- GenBank Accession Number:
- BC029831
- Protein Accession Number:
- AAH29831