CCR2 Mouse Monoclonal Antibody (M01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Clone:
- 4D12
- Description:
- CCR2 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant CCR2 (1 a.a. - 42 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgM kappa
- Molecular Weight (kDa):
- 30.36 (Immunogen)
- Sequence:
- MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- CCR2
- Gene Description:
- CCR2 (C-C Motif Chemokine Receptor 2) is a protein coding gene. The protein encoded by this gene is a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The encoded protein mediates agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This protein can also be a coreceptor with CD4 for HIV-1 infection. This gene is located in the chemokine receptor gene cluster region of chromosome 3. [provided by RefSeq, Aug 2017]
- GenBank Accession Number:
- NM_000648
- Protein Accession Number:
- NP_000639