Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 4D12

• Description:
• CCR2 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant CCR2 (1 a.a. - 42 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgM kappa

• Molecular Weight (kDa):
• 30.36 (Immunogen)

• Sequence:
• MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• CCR2

• Gene Description:
• CCR2 (C-C Motif Chemokine Receptor 2) is a protein coding gene. The protein encoded by this gene is a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The encoded protein mediates agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This protein can also be a coreceptor with CD4 for HIV-1 infection. This gene is located in the chemokine receptor gene cluster region of chromosome 3. [provided by RefSeq, Aug 2017]

• GenBank Accession Number:
• NM_000648

• Protein Accession Number:
• NP_000639