CCR2 Mouse Monoclonal Antibody (M01A)

CCR2 Mouse Monoclonal Antibody (M01A)

For Research Use Only. Not For Clinical Use.

Catalog Number: MAB-M0017

Host: Mouse

Reactivity: Human

Product Size Price
200 μL Online Inquiry

Applications

  • Applications:
  • Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

  • Clone:
  • 4D12
  • Description:
  • CCR2 Mouse Monoclonal Antibody (M01A) is raised against a partial recombinant CCR2 (1 a.a. - 42 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Isotype:
  • IgM kappa
  • Molecular Weight (kDa):
  • 30.36 (Immunogen)
  • Sequence:
  • MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA
  • Storage Buffer:
  • In ascites fluid
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • CCR2
  • Gene Description:
  • CCR2 (C-C Motif Chemokine Receptor 2) is a protein coding gene. The protein encoded by this gene is a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The encoded protein mediates agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This protein can also be a coreceptor with CD4 for HIV-1 infection. This gene is located in the chemokine receptor gene cluster region of chromosome 3. [provided by RefSeq, Aug 2017]
  • GenBank Accession Number:
  • NM_000648
  • Protein Accession Number:
  • NP_000639