Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 2B11

• Description:
• CX3CR1 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant CX3CR1 (1 a.a. - 36 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 29.7 (Immunogen)

• Sequence:
• MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSI

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• CX3CR1

• Gene Description:
• CX3CR1 (C-X3-C Motif Chemokine Receptor 1) is a protein coding gene. Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]

• GenBank Accession Number:
• BC028078

• Protein Accession Number:
• AAH28078