Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 1C5

• Description:
• CXCR3 Mouse Monoclonal Antibody (M01A) is raised against a partial recombinant CXCR3 (1 a.a. - 53 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgM kappa

• Molecular Weight (kDa):
• 31.57 (Immunogen)

• Sequence:
• MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR

• Storage Buffer:
• In ascites fluid

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• CXCR3

• Gene Description:
• CXCR3 (C-X-C Motif Chemokine Receptor 3) is a protein coding gene. This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant). Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716). [provided by RefSeq, Jun 2011]

• GenBank Accession Number:
• NM_001504

• Protein Accession Number:
• NP_001495.1