CXCR4 Mouse Monoclonal Antibody (M03)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Clone:
- 2A9
- Description:
- CXCR4 Mouse Monoclonal Antibody (M03) is raised against a partial recombinant CXCR4 (1 a.a. - 46 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG1 kappa
- Molecular Weight (kDa):
- 30.8 (Immunogen)
- Sequence:
- MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- CXCR4
- Gene Description:
- CXCR4 (C-X-C Motif Chemokine Receptor 4) is a protein coding gene. This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
- GenBank Accession Number:
- BC020968
- Protein Accession Number:
- AAH20968