Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 2C1

• Description:
• CXCR5 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant CXCR5 (1 a.a. - 55 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 32.16 (Immunogen)

• Sequence:
• MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVP

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• CXCR5

• Gene Description:
• CXCR5 (C-X-C Motif Chemokine Receptor 5) is a protein coding gene. This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]

• GenBank Accession Number:
• NM_001716

• Protein Accession Number:
• NP_001707