EDG1 Mouse Monoclonal Antibody (M03)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Clone:
- 1F11
- Description:
- EDG1 Mouse Monoclonal Antibody (M03) is raised against a partial recombinant EDG1 (1 a.a. - 47 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG3 kappa
- Molecular Weight (kDa):
- 30.91 (Immunogen)
- Sequence:
- MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- S1PR1
- Gene Description:
- S1PR1 (Sphingosine-1-Phosphate Receptor 1) is a protein coding gene. The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
- GenBank Accession Number:
- BC018650
- Protein Accession Number:
- AAH18650