Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 1F11

• Description:
• EDG1 Mouse Monoclonal Antibody (M03) is raised against a partial recombinant EDG1 (1 a.a. - 47 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG3 kappa

• Molecular Weight (kDa):
• 30.91 (Immunogen)

• Sequence:
• MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• S1PR1

• Gene Description:
• S1PR1 (Sphingosine-1-Phosphate Receptor 1) is a protein coding gene. The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

• GenBank Accession Number:
• BC018650

• Protein Accession Number:
• AAH18650