Applications

• Applications:
• Immunohistochemistry, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 2G11

• Description:
• EDG3 Mouse Monoclonal Antibody (M02) is raised against a partial recombinant EDG3 (320 a.a. - 378 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG1 kappa

• Sequence:
• SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• S1PR3

• Gene Description:
• S1PR3 (Sphingosine-1-Phosphate Receptor 3) is a protein coding gene. This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function. [provided by RefSeq, Jul 2008]

• GenBank Accession Number:
• NM_005226

• Protein Accession Number:
• NP_005217.2