EMR4P Mouse Monoclonal Antibody (M02)

EMR4P Mouse Monoclonal Antibody (M02)

For Research Use Only. Not For Clinical Use.

Catalog Number: MAB-M0046

Host: Mouse

Reactivity: Human

Product Size Price
100 μg Online Inquiry

Applications

  • Applications:
  • Western Blot, Immunofluorescence, Enzyme-Linked Immunoabsrbent Assay

Specification

  • Clone:
  • 1G10
  • Description:
  • EMR4P Mouse Monoclonal Antibody (M02) is raised against a partial recombinant EMR4P (21 a.a. - 93 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Isotype:
  • IgG2a kappa
  • Molecular Weight (kDa):
  • 33.77 (Immunogen)
  • Sequence:
  • GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • EMR4P
  • Gene Description:
  • EMR4P (egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene) is a pseudogene. This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq, Aug 2008]
  • GenBank Accession Number:
  • XM_377506
  • Protein Accession Number:
  • XP_377506