EMR4P Mouse Monoclonal Antibody (M02)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Immunofluorescence, Enzyme-Linked Immunoabsrbent Assay
Specification
- Clone:
- 1G10
- Description:
- EMR4P Mouse Monoclonal Antibody (M02) is raised against a partial recombinant EMR4P (21 a.a. - 93 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG2a kappa
- Molecular Weight (kDa):
- 33.77 (Immunogen)
- Sequence:
- GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- EMR4P
- Gene Description:
- EMR4P (egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene) is a pseudogene. This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq, Aug 2008]
- GenBank Accession Number:
- XM_377506
- Protein Accession Number:
- XP_377506