Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay, In Situ Proximity Ligation Assay

Specification

• Clone:
• 2C5

• Description:
• F2R Mouse Monoclonal Antibody (M01) is raised against a partial recombinant F2R (42 a.a. - 102 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2b kappa

• Molecular Weight (kDa):
• 32.45 (Immunogen)

• Sequence:
• SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• F2R

• Gene Description:
• F2R (Coagulation Factor II Thrombin Receptor) is a protein coding gene. Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]

• GenBank Accession Number:
• NM_001992

• Protein Accession Number:
• NP_001983.1