FPR2 Mouse Monoclonal Antibody (M03)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Clone:
- 2G8
- Description:
- FPR2 Mouse Monoclonal Antibody (M03) is raised against a partial recombinant FPR2 (163 a.a. - 205 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG2a kappa
- Molecular Weight (kDa):
- 30.36 (Immunogen)
- Sequence:
- FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- FPR2
- Gene Description:
- FPR2 (Formyl Peptide Receptor 2) is a protein coding gene. The Formyl-peptide receptor-2 (FPR2) is a seven transmembrane G protein-coupled receptor. It is involved in antibacterial host defence and inflammation.
- GenBank Accession Number:
- BC029125
- Protein Accession Number:
- AAH29125.1