Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 2G8

• Description:
• FPR2 Mouse Monoclonal Antibody (M03) is raised against a partial recombinant FPR2 (163 a.a. - 205 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 30.36 (Immunogen)

• Sequence:
• FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• FPR2

• Gene Description:
• FPR2 (Formyl Peptide Receptor 2) is a protein coding gene. The Formyl-peptide receptor-2 (FPR2) is a seven transmembrane G protein-coupled receptor. It is involved in antibacterial host defence and inflammation.

• GenBank Accession Number:
• BC029125

• Protein Accession Number:
• AAH29125.1