FZD2 Mouse Monoclonal Antibody (M05)

FZD2 Mouse Monoclonal Antibody (M05)

For Research Use Only. Not For Clinical Use.

Catalog Number: MAB-M0054

Host: Mouse

Reactivity: Human

Product Size Price
100 μg Online Inquiry

Applications

  • Applications:
  • Enzyme-Linked Immunoabsorbent Assay

Specification

  • Clone:
  • 1E7
  • Description:
  • FZD2 Mouse Monoclonal Antibody (M05) is raised against a partial recombinant FZD2 (192 a.a. - 245 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Isotype:
  • IgG2b kappa
  • Sequence:
  • YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • FZD2
  • Gene Description:
  • FZD2 (Frizzled Class Receptor 2) is a protein coding gene. This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. This gene encodes a protein that is coupled to the beta-catenin canonical signaling pathway. Competition between the wingless-type MMTV integration site family, member 3A and wingless-type MMTV integration site family, member 5A gene products for binding of this protein is thought to regulate the beta-catenin-dependent and -independent pathways. [provided by RefSeq, Dec 2010]
  • GenBank Accession Number:
  • NM_001466
  • Protein Accession Number:
  • NP_001457