Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 1B8

• Description:
• FZD3 Mouse Monoclonal Antibody (M02) is raised against a partial recombinant FZD3 (55 a.a. - 157 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 37.07 (Immunogen)

• Sequence:
• QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• FZD3

• Gene Description:
• FZD3 (Frizzled Class Receptor 3) is a protein coding gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia. [provided by RefSeq, Dec 2010]

• GenBank Accession Number:
• NM_017412

• Protein Accession Number:
• NP_059108