FZD3 Mouse Monoclonal Antibody (M09)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Immunofluorescence, Enzyme-Linked Immunoabsrbent Assay
Specification
- Clone:
- 2H5
- Description:
- FZD3 Mouse Monoclonal Antibody (M09) is raised against a partial recombinant FZD3 (55 a.a. - 157 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG2a kappa
- Molecular Weight (kDa):
- 37.07 (Immunogen)
- Sequence:
- QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- FZD3
- Gene Description:
- FZD3 (Frizzled Class Receptor 3) is a protein coding gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia. [provided by RefSeq, Dec 2010]
- GenBank Accession Number:
- NM_017412
- Protein Accession Number:
- NP_059108