FZD3 Mouse Monoclonal Antibody (M09)

FZD3 Mouse Monoclonal Antibody (M09)

For Research Use Only. Not For Clinical Use.

Catalog Number: MAB-M0056

Host: Mouse

Reactivity: Human

Product Size Price
100 μg Online Inquiry

Applications

  • Applications:
  • Western Blot, Immunofluorescence, Enzyme-Linked Immunoabsrbent Assay

Specification

  • Clone:
  • 2H5
  • Description:
  • FZD3 Mouse Monoclonal Antibody (M09) is raised against a partial recombinant FZD3 (55 a.a. - 157 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Isotype:
  • IgG2a kappa
  • Molecular Weight (kDa):
  • 37.07 (Immunogen)
  • Sequence:
  • QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • FZD3
  • Gene Description:
  • FZD3 (Frizzled Class Receptor 3) is a protein coding gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia. [provided by RefSeq, Dec 2010]
  • GenBank Accession Number:
  • NM_017412
  • Protein Accession Number:
  • NP_059108