Applications

• Applications:
• Western Blot, Immunoprecipitation, Enzyme-Linked Immunoabsorbent Assay, In Situ Proximity Ligation Assay

Specification

• Clone:
• 6A3

• Description:
• FZD5 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant FZD5 (72 a.a. - 161 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 35.64 (Immunogen)

• Sequence:
• PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• FZD5

• Gene Description:
• FZD5 (Frizzled Class Receptor 5) is a protein coding gene. Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand. [provided by RefSeq, Jul 2008]

• GenBank Accession Number:
• NM_003468

• Protein Accession Number:
• ENSP00000354607