Applications

• Applications:
• Western Blot, Immunohistochemistry, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 4D9

• Description:
• FZD7 Mouse Monoclonal Antibody (M03) is raised against a partial recombinant FZD7 (155 a.a. - 253 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG1 kappa

• Molecular Weight (kDa):
• 36.63 (Immunogen)

• Sequence:
• GAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFA

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• FZD7

• Gene Description:
• FZD7 (Frizzled Class Receptor 7) is a protein coding gene. Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas. [provided by RefSeq, Jul 2008]

• GenBank Accession Number:
• NM_003507

• Protein Accession Number:
• NP_0.03498.1