Applications

• Applications:
• Western Blot, Immunofluorescence, Enzyme-Linked Immunoabsrbent Assay

Specification

• Clone:
• 2D7

• Description:
• GABBR1 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant GABBR1 (52 a.a. - 151 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 36.63 (Immunogen)

• Sequence:
• AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GABBR1

• Gene Description:
• GABBR1 (Gamma-Aminobutyric Acid Type B Receptor Subunit 1) is a protein coding gene. This gene encodes a receptor for gamma-aminobutyric acid (GABA), which is the main inhibitory neurotransmitter in the mammalian central nervous system. This receptor functions as a heterodimer with GABA(B) receptor 2. Defects in this gene may underlie brain disorders such as schizophrenia and epilepsy. Alternative splicing generates multiple transcript variants, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jan 2016]

• GenBank Accession Number:
• BC050532

• Protein Accession Number:
• AAH50532