Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 2F5

• Description:
• GPR154 Mouse Monoclonal Antibody (M01)is raised against a partial recombinant GPR154 (2 a.a. - 53 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG1 kappa

• Molecular Weight (kDa):
• 31.46 (Immunogen)

• Sequence:
• PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• NPSR1

• Gene Description:
• NPSR1 (Neuropeptide S Receptor 1) is a protein coding gene. This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Polymorphisms in this gene have also been associated with asthma susceptibility, panic disorders, inflammatory bowel disease, and rheumatoid arthritis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

• GenBank Accession Number:
• NM_207173

• Protein Accession Number:
• NP_997056