Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 1B2

• Description:
• GPR161 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant GPR161 (362 a.a. - 460 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 36.63 (Immunogen)

• Sequence:
• SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GPR161

• Gene Description:
• GPR161 (G Protein-Coupled Receptor 161) is a protein coding gene. The protein encoded by this gene is an orphan G protein-coupled receptor whose ligand is unknown. This gene is overexpressed in triple-negative breast cancer, and disruption of this gene slows the proliferation of basal breast cancer cells. Therefore, this gene is a potential drug target for triple-negative breast cancer. [provided by RefSeq, Mar 2017]

• GenBank Accession Number:
• NM_153832

• Protein Accession Number:
• NP_722561.1