GPR182 Mouse Monoclonal Antibody (M04)

GPR182 Mouse Monoclonal Antibody (M04)

For Research Use Only. Not For Clinical Use.

Catalog Number: MAB-M0068

Host: Mouse

Reactivity: Human

Product Size Price
100 μg Online Inquiry

Applications

  • Applications:
  • Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

  • Clone:
  • 3B10
  • Description:
  • GPR182 Mouse Monoclonal Antibody (M04) is raised against a partial recombinant GPR182 (1 a.a. - 54 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Isotype:
  • IgG2a kappa
  • Molecular Weight (kDa):
  • 31.68 (Immunogen)
  • Sequence:
  • MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRV
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • GPR182
  • Gene Description:
  • GPR182 (G Protein-Coupled Receptor 182) is a protein coding gene. Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin. [provided by RefSeq, Jul 2008]
  • GenBank Accession Number:
  • NM_007264
  • Protein Accession Number:
  • NP_009195