GPR182 Mouse Monoclonal Antibody (M04)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Clone:
- 3B10
- Description:
- GPR182 Mouse Monoclonal Antibody (M04) is raised against a partial recombinant GPR182 (1 a.a. - 54 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG2a kappa
- Molecular Weight (kDa):
- 31.68 (Immunogen)
- Sequence:
- MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRV
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- GPR182
- Gene Description:
- GPR182 (G Protein-Coupled Receptor 182) is a protein coding gene. Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin. [provided by RefSeq, Jul 2008]
- GenBank Accession Number:
- NM_007264
- Protein Accession Number:
- NP_009195