GPR84 Mouse Monoclonal Antibody (M01)

GPR84 Mouse Monoclonal Antibody (M01)

For Research Use Only. Not For Clinical Use.

Catalog Number: MAB-M0071

Host: Mouse

Reactivity: Human

Product Size Price
100 μg Online Inquiry

Applications

  • Applications:
  • Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

  • Clone:
  • 5C3
  • Description:
  • GPR84 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant GPR84 (208 a.a. - 316 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Isotype:
  • IgG1 kappa
  • Molecular Weight (kDa):
  • 37.73 (Immunogen)
  • Sequence:
  • AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGK
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • GPR84
  • Gene Description:
  • GPR84 (G Protein-Coupled Receptor 84) is a protein coding gene, which encodes the receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. It may involved in the process from fatty acid metabolism to regulation of the immune system.
  • GenBank Accession Number:
  • NM_020370
  • Protein Accession Number:
  • NP_065103