GPRC5D Mouse Monoclonal Antibody (M01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Clone:
- 6D9
- Description:
- GPRC5D Mouse Monoclonal Antibody (M01) is raised against a partial recombinant GPRC5D (261 a.a. - 345 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG2b kappa
- Molecular Weight (kDa):
- 35.09 (Immunogen)
- Sequence:
- ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- GPRC5D
- Gene Description:
- GPRC5D (G Protein-Coupled Receptor Class C Group 5 Member D) is a protein coding gene. The protein encoded by this gene is a member of the G protein-coupled receptor family; however, the specific function of this gene has not yet been determined. [provided by RefSeq, Jul 2008]
- GenBank Accession Number:
- NM_018654
- Protein Accession Number:
- NP_061124