Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 6D9

• Description:
• GPRC5D Mouse Monoclonal Antibody (M01) is raised against a partial recombinant GPRC5D (261 a.a. - 345 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2b kappa

• Molecular Weight (kDa):
• 35.09 (Immunogen)

• Sequence:
• ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GPRC5D

• Gene Description:
• GPRC5D (G Protein-Coupled Receptor Class C Group 5 Member D) is a protein coding gene. The protein encoded by this gene is a member of the G protein-coupled receptor family; however, the specific function of this gene has not yet been determined. [provided by RefSeq, Jul 2008]

• GenBank Accession Number:
• NM_018654

• Protein Accession Number:
• NP_061124