Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay, In Situ Proximity Ligation Assay

Specification

• Clone:
• 1B3

• Description:
• GRM5 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant GRM5 (419 a.a. - 518 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 36.74 (Immunogen)

• Sequence:
• CPGYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKG

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• GRM5

• Gene Description:
• GRM5 (Glutamate Metabotropic Receptor 5) is a protein coding gene. This gene encodes a member of the G-protein coupled receptor 3 protein family. The encoded protein is a metabatropic glutamate receptor, whose signaling activates a phosphatidylinositol-calcium second messenger system. This protein may be involved in the regulation of neural network activity and synaptic plasticity. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. A pseudogene of this gene has been defined on chromosome 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

• GenBank Accession Number:
• NM_000842

• Protein Accession Number:
• NP_000833