Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay, RNAi Knowckdown

Specification

• Clone:
• 1E3

• Description:
• HCRTR2 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant HCRTR2 (1 a.a. - 54 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG1 kappa

• Molecular Weight (kDa):
• 31.68 (Immunogen)

• Sequence:
• MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• HCRTR2

• Gene Description:
• HCRTR2 (Hypocretin Receptor 2) is a protein coding gene. The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein binds the hypothalamic neuropeptides orexin A and orexin B. A related gene (HCRTR1) encodes a G-protein coupled receptor that selectively binds orexin A. [provided by RefSeq, Jan 2009]

• GenBank Accession Number:
• NM_001526

• Protein Accession Number:
• NP_001517