HRH1 Mouse Monoclonal Antibody (M03)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Enzyme-Linked Immunoabsorbent Assay, In Situ Proximity Ligation Assay
Specification
- Clone:
- 3D1
- Description:
- HRH1 Mouse Monoclonal Antibody (M03) is raised against a partial recombinant HRH1 (312 a.a. - 414 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG1 kappa
- Sequence:
- AAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAA
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- HRH1
- Gene Description:
-
HRH1 (Histamine Receptor H1) is a protein coding gene. Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. The protein encoded by this gene is an integral membrane protein and belongs to the G protein-coupled receptor superfamily. It mediates the contraction of smooth muscles, the increase in capillary permeability due to contraction of terminal venules, the release of catecholamine from adrenal medulla, and neurotransmission in the central nervous system. It has been associated with multiple processes, including memory and learning, circadian rhythm, and thermoregulation. It is also known to contribute to the pathophysiology of allergic diseases such as atopic dermatitis, asthma, anaphylaxis and allergic rhinitis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jan 2015]
- GenBank Accession Number:
- NM_000861
- Protein Accession Number:
- NP_000852.1