Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 2E9

• Description:
• HTR1E Mouse Monoclonal Antibody (M03) is raised against a partial recombinant HTR1E (206 a.a. - 276 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 33.55 (Immunogen)

• Sequence:
• YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• HTR1E

• Gene Description:
• HTR1E (5-Hydroxytryptamine Receptor 1E) is a protein coding gene. It is specifically expressed in the human hippocampus and frontal cortex. The receptor has the ability to identify any mutation in neurologic and psychiatric diseases.

• GenBank Accession Number:
• NM_000865

• Protein Accession Number:
• NP_000856.1