HTR2B Mouse Monoclonal Antibody (M09)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Enzyme-Linked Immunoabsorbent Assay
Specification
- Clone:
- 4F3
- Description:
- HTR2B Mouse Monoclonal Antibody (M09) is raised against a partial recombinant HTR2B (199 a.a. - 359 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG2b kappa
- Sequence:
- VDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQ
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- HTR2B
- Gene Description:
-
HTR2B (5-Hydroxytryptamine Receptor 2B) is a protein coding gene. This gene encodes one of the several different receptors for 5-hydroxytryptamine (serotonin) that belongs to the G-protein coupled receptor 1 family. Serotonin is a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Serotonin receptors mediate many of the central and peripheral physiologic functions of serotonin, including regulation of cardiovascular functions and impulsive behavior. Population and family-based analyses of a minor allele (glutamine-to-stop substitution, designated Q20*) which blocks expression of this protein, and knockout studies in mice, suggest a role for this gene in impulsivity. However, other factors, such as elevated testosterone levels, may also be involved. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2016]
- GenBank Accession Number:
- BC063123
- Protein Accession Number:
- AAG63123.1