HTR5A Mouse Monoclonal Antibody (M01)

HTR5A Mouse Monoclonal Antibody (M01)

For Research Use Only. Not For Clinical Use.

Catalog Number: MAB-M0089

Host: Mouse

Reactivity: Human

Product Size Price
100 μg Online Inquiry

Applications

  • Applications:
  • Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

  • Clone:
  • 10D3
  • Description:
  • HTR5A Mouse Monoclonal Antibody (M01) is raised against a partial recombinant HTR5A (223 a.a. - 282 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Isotype:
  • IgG1 kappa
  • Molecular Weight (kDa):
  • 32.34 (Immunogen)
  • Sequence:
  • IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • HTR5A
  • Gene Description:
  • HTR5A (5-Hydroxytryptamine Receptor 5A) is a protein coding gene. The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq, Jul 2008]
  • GenBank Accession Number:
  • NM_024012
  • Protein Accession Number:
  • NP_076917