Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 8F6

• Description:
• LGR4 Mouse Monoclonal Antibody (M03) is raised against a partial recombinant LGR4 (852 a.a. - 950 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 36.52 (Immunogen)

• Sequence:
• QGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVK

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• LGR4

• Gene Description:
• LGR4 (Leucine Rich Repeat Containing G Protein-Coupled Receptor 4) is a protein coding gene. The protein encoded by this gene is a G-protein coupled receptor that binds R-spondins and activates the Wnt signaling pathway. This Wnt signaling pathway activation is necessary for proper development of many organs of the body. [provided by RefSeq, Oct 2016]

• GenBank Accession Number:
• NM_018490

• Protein Accession Number:
• NP_060960.1