Applications

• Applications:
• Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 3A1

• Description:
• NPY1R Mouse Monoclonal Antibody (M21) is raised against a full-length recombinant NPY1R (1 a.a. - 384 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Sequence:
• MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVPITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVYDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• NPY1R

• Gene Description:
• NPY1R (Neuropeptide Y Receptor Y1) is a protein coding gene. This gene belongs to the G-protein-coupled receptor superfamily. The encoded transmembrane protein mediates the function of neuropeptide Y (NPY), a neurotransmitter, and peptide YY (PYY), a gastrointestinal hormone. The encoded receptor undergoes fast agonist-induced internalization through clathrin-coated pits and is subsequently recycled back to the cell membrane. Activation of Y1 receptors may result in mobilization of intracellular calcium and inhibition of adenylate cyclase activity. [provided by RefSeq, Aug 2013]

• GenBank Accession Number:
• BC036657

• Protein Accession Number:
• AAH36657