Applications

• Applications:
• Western Blot, Immunofluorescence, Enzyme-Linked Immunoabsrbent Assay

Specification

• Clone:
• 4C2

• Description:
• P2RY1 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant P2RY1 (1 a.a. - 52 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 31.46 (Immunogen)

• Sequence:
• MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• P2RY1

• Gene Description:
• P2RY1 (Purinergic Receptor P2Y1) is a protein coding gene. The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation. [provided by RefSeq, Jul 2008]

• GenBank Accession Number:
• NM_002563

• Protein Accession Number:
• NP_002554