PTGIR Mouse Monoclonal Antibody (M01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Immunohistochemistry, Enzyme-Linked Immunoabsorbent Assay
Specification
- Clone:
- 4B10
- Description:
- PTGIR Mouse Monoclonal Antibody (M01) is raised against a partial recombinant PTGIR (296 a.a. - 386 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG1 kappa
- Molecular Weight (kDa):
- 35.75 (Immunogen)
- Sequence:
- RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- PTGIR
- Gene Description:
- PTGIR (Prostaglandin I2 Receptor) is a protein coding gene. The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor. [provided by RefSeq, Jul 2008]
- GenBank Accession Number:
- NM_000960
- Protein Accession Number:
- NP_000951