Applications

• Applications:
• Western Blot, Immunohistochemistry, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 4B10

• Description:
• PTGIR Mouse Monoclonal Antibody (M01) is raised against a partial recombinant PTGIR (296 a.a. - 386 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG1 kappa

• Molecular Weight (kDa):
• 35.75 (Immunogen)

• Sequence:
• RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• PTGIR

• Gene Description:
• PTGIR (Prostaglandin I2 Receptor) is a protein coding gene. The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor. [provided by RefSeq, Jul 2008]

• GenBank Accession Number:
• NM_000960

• Protein Accession Number:
• NP_000951