Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 3H1

• Description:
• SCTR Mouse Monoclonal Antibody (M01) is raised against a partial recombinant SCTR (32 a.a. - 141 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG2a kappa

• Molecular Weight (kDa):
• 37.84 (Immunogen）

• Sequence:
• CDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLK

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• SCTR

• Gene Description:
• SCTR (Secretin Receptor) is a protein coding gene. The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. [provided by RefSeq, Jul 2008]
  

• GenBank Accession Number:
• NM_002980

• Protein Accession Number:
• NP_002971