Applications

• Applications:
• Enzyme-Linked Immunoabsorbent Assay

Specification

• Clone:
• 2F12

• Description:
• SMO Mouse Monoclonal Antibody (M10) is raised against a partial recombinant SMO (56 a.a. - 155 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Isotype:
• IgG1 kappa

• Sequence:
• GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA

• Storage Buffer:
• In 1× PBS, pH 7.4

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• SMO

• Gene Description:
• SMO (Smoothened, Frizzled Class Receptor) is a protein coding gene. The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex. [provided by RefSeq, Jul 2010]

• GenBank Accession Number:
• NM_005631

• Protein Accession Number:
• NP_005622