SMO Mouse Monoclonal Antibody (M12)

SMO Mouse Monoclonal Antibody (M12)

For Research Use Only. Not For Clinical Use.

Catalog Number: MAB-M0121

Host: Mouse

Reactivity: Human

Product Size Price
100 μg Online Inquiry

Applications

  • Applications:
  • Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

  • Clone:
  • 2D10
  • Description:
  • SMO Mouse Monoclonal Antibody (M12) is raised against a full-length recombinant SMO (653 a.a. - 787 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
  • Isotype:
  • IgG2a kappa
  • Molecular Weight (kDa):
  • 40.37 (Immunogen)
  • Sequence:
  • NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF
  • Storage Buffer:
  • In 1× PBS, pH 7.4
  • Storage:
  • Store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.

Gene Information

  • Gene Name:
  • SMO
  • Gene Description:
  • SMO (Smoothened, Frizzled Class Receptor) is a protein coding gene. The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex. [provided by RefSeq, Jul 2010]
  • GenBank Accession Number:
  • NM_005631
  • Protein Accession Number:
  • NP_005622.1