SSR2 Mouse Monoclonal Antibody (M01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Immunofluorescence, Enzyme-Linked Immunoabsrbent Assay
Specification
- Clone:
- 4C1
- Description:
- SSR2 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant SSR2 (51 a.a. - 150 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG2a kappa
- Molecular Weight (kDa):
- 36.74 (Immunogen)
- Sequence:
- SSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDW
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- SSR2
- Gene Description:
-
SSR2 (Signal Sequence Receptor Subunit 2) is a protein coding gene. The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2). The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23. [provided by RefSeq, Jul 2008]
- GenBank Accession Number:
- NM_003145
- Protein Accession Number:
- NP_003136.1