VIPR2 Mouse Monoclonal Antibody (M01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Clone:
- 2E3
- Description:
- VIPR2 Mouse Monoclonal Antibody (M01) is raised against a partial recombinant VIPR2 (24 a.a. - 126 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Isotype:
- IgG2a kappa
- Molecular Weight (kDa):
- 37.07 (Immunogen)
- Sequence:
- ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILV
- Storage Buffer:
- In 1× PBS, pH 7.4
- Storage:
-
Short term storage: 4°C.
Long term storage: -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- VIPR2
- Gene Description:
- VIPR2 (Vasoactive Intestinal Peptide Receptor 2) is a protein coding gene. This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its actions are effected through integral membrane receptors associated with a guanine nucleotide binding protein which activates adenylate cyclase. [provided by RefSeq, Aug 2011]v
- GenBank Accession Number:
- NM_003382
- Protein Accession Number:
- NP_003373