BAI2 Mouse Polyclonal Antibody (A01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Western Blot, Enzyme-Linked Immunoabsorbent Assay
Specification
- Description:
- BAI2 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant BAI2 (22 a.a. - 108 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Molecular Weight (kDa):
- 35.68 (Immunogen)
- Sequence:
- DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ
- Storage Buffer:
- 50% glycerol
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- BAI2
- Gene Description:
-
BAI2 (brain-specific angiogenesis inhibitor 2) is a protein-coding gene. BAI1, a p53-target gene, encodes brain-specific angiogenesis inhibitor, a seven-span transmembrane protein and is thought to be a member of the secretin receptor family. Brain-specific angiogenesis proteins BAI2 and BAI3 are
similar to BAI1 in structure, have similar tissue specificities and may also play a role in angiogenesis. [provided by RefSeq, Jul 2008]
- GenBank Accession Number:
- NM_001703
- Protein Accession Number:
- NP_001694