BAI3 Mouse Polyclonal Antibody (A01)
For Research Use Only. Not For Clinical Use.
Applications
- Applications:
- Enzyme-Linked Immunoabsorbent Assay
Specification
- Description:
- BAI3 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant BAI3 (26 a.a. - 135 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.
- Sequence:
- QDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLENPDPTKYSIYLKFSKKDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCNSKNAFVFLQYDKNFIQIRRVFP
- Storage Buffer:
- 50% glycerol
- Storage:
-
Store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Gene Information
- Gene Name:
- BAI3
- Gene Description:
- BAI3 (brain-specific angiogenesis inhibitor 3) is a protein-coding gene. This p53-target gene encodes a brain-specific angiogenesis inhibitor, a seven-span transmembrane protein, and is thought to be a member of the secretin receptor family. Brain-specific angiogenesis proteins BAI2 and BAI3 are similar to BAI1 in structure, have similar tissue specificities, and may also play a role in angiogenesis. [provided by RefSeq, Jul 2008]
- GenBank Accession Number:
- NM_001704
- Protein Accession Number:
- NP_001695