Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• BRS3 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant BRS3 (290 a.a. - 399 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 38.21 (Immunogen)

• Sequence:
• LYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADTSLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• BRS3

• Gene Description:
• BRS3 (Bombesin Receptor Subtype 3) is a Protein Coding gene. The protein encoded by this gene is a G protein-coupled membrane receptor that binds bombesin-like peptides. This binding results in activation of a phosphatidylinositol-calcium second messenger system, with physiological effects including regulation of metabolic rate, glucose metabolism, and hypertension. [provided by RefSeq, Sep 2011]

• GenBank Accession Number:
• NM_001727

• Protein Accession Number:
• NP_001718