Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• C5R1 Mouse Polyclonal Antibody (A01) is raised against a partial recombinant C5R1 (241 a.a. - 350 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 38.21 (Immunogen)

• Sequence:
• LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNKLDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• C5AR1

• Gene Description:
• C5AR1 (Complement C5a Receptor 1) is a protein coding gene, which encodes the receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. The activation of this receptor can stimulate granule enzyme release, chemotaxis, intracellular calcium release and superoxide anion production

• GenBank Accession Number:
• BC008982

• Protein Accession Number:
• AAH08982