Applications

• Applications:
• Western Blot, Enzyme-Linked Immunoabsorbent Assay

Specification

• Description:
• CALCRL Mouse Polyclonal Antibody (A01) is raised against a partial recombinant CALCRL (23 a.a. - 132 a.a.) with GST tag. The molecular weight of the GST tag is 26 kDa.

• Molecular Weight (kDa):
• 38.21 (Transfected lysate)

• Sequence:
• ELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTH

• Storage Buffer:
• 50% glycerol

• Storage:
• Store at -20°C or lower.
  Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name:
• CALCR

• Gene Description:
• CALCR (Calcitonin Receptor) is a protein coding gene, which encodes a high affinity receptor for the peptide hormone calcitonin and belongs to a subfamily of seven transmembrane-spanning G protein-coupled receptors. The encoded protein is involved in maintaining calcium homeostasis and in regulating osteoclast-mediated bone resorption. Polymorphisms in this gene have been associated with variations in bone mineral density and onset of osteoporosis. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]

• GenBank Accession Number:
• NM_005795

• Protein Accession Number:
• NP_005786